SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000051846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000051846
Domain Number 1 Region: 19-46,89-156
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-20
Family Voltage-gated potassium channels 0.0067
Further Details:      
 
Domain Number 2 Region: 189-283
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-18
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000051846
Sequence length 405
Comment (Mus musculus)
Sequence
MAGRGCGCSPGHLNEDNARFLLLAGLILLYLLGGAAVFSALELAQELQAKQRWEERLANF
SRGHNLSREELRGFLRHYEEATRAGIRMDSVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT
TGGKIFLIFYGLIGCASTILFFNLFLERLITVIACVMRSCHQQQLRRRGAVTQDNMKAPE
KGEADSLTGWKPSVYYVMLILCLASVAISCGASALYTTMEGWSYFDSVYFCFVAFSTIGF
GDLVSSQNAQYESQGLYRFFNFFLILMGVCCIYSLFNVISILIKQTVNWILRKLDSGCFP
PCQRGLLRSRRNVVMPGNIRNRCNISIETDGVMESDTDGRRLSGEMISMKDTNKVSLAIL
QKQLSEMANGGPHQNSASSRDDEFSGGVGAFAVMNNRLAETSGDR
Download sequence
Identical sequences Q3TYG8 Q8R1P5
ENSMUSP00000051846 ENSMUSP00000123916 ENSMUSP00000136882 ENSMUSP00000051846 ENSMUSP00000051846 NP_001157898.1.92730 NP_001157899.1.92730 NP_666149.1.92730 10090.ENSMUSP00000051846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]