SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000055673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000055673
Domain Number 1 Region: 239-265,307-509
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-60
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 111-208
Classification Level Classification E-value
Superfamily POZ domain 3.66e-26
Family Tetramerization domain of potassium channels 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000055673
Sequence length 602
Comment (Mus musculus)
Sequence
MEISLVPMENGSAMTLRGGGEAGASCVQSPRGECGCPPTAGLNNQSKETSPRRRATHEDA
GQGGRPLPPMPQELPQPRRPSAEDEEGEGDPGLGTVEEDQAPQDSGSLHHQRVLINISGL
RFETQLGTLAQFPNTLLGDPVKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV
NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA
RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGANGSGSGVLSSG
PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDIVAIFPYF
ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM
RELGLLIFFLFIGVILFSSAVYFAEADNQGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV
GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGIQRRESGLDTG
GQRKVSCSKASFCKTGGPLESTDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET
DL
Download sequence
Identical sequences Q61762
10090.ENSMUSP00000055673 ENSMUSP00000055673 ENSMUSP00000055673 NP_666095.1.92730 ENSMUSP00000055673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]