SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000056814 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000056814
Domain Number 1 Region: 5-117
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.09e-33
Family MHC antigen-recognition domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 128-216
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-26
Family C1 set domains (antibody constant domain-like) 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000056814
Sequence length 287
Comment (Mus musculus)
Sequence
MVSLWLPRGLCVAAVILSLMMLTPPVILVRDPRPRFLEQLKAECHYFNGKERVWSVTRFI
YNQEEFARFNSDFGKFLAVTELGRPIVEYLNTQKDMLDNYRASVDRCRNNYDLVDIFMLN
LKAEPKVTVYPAKTQPLEHHNLLVCSVIDFYPGSIEVRWFRNGEEEKTGVVSTGLIQNRD
WTYQTLVMLEMVPRGGEVYTCQVEHPSLTSPVTVEWRARSTSAQNKLLSGVMGMALGLFI
LAVGLFFYLRNLRAGSVSHGAGEGAESFTSRLTGSGSECHMGPGLSI
Download sequence
Identical sequences Q3UUV9
NP_001029150.1.92730 10090.ENSMUSP00000056814 ENSMUSP00000056814 ENSMUSP00000056814 ENSMUSP00000056814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]