SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000058723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000058723
Domain Number 1 Region: 41-132
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.71e-21
Family Supernatant protein factor (SPF), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000058723
Sequence length 221
Comment (Mus musculus)
Sequence
MVHEAPHASSFQMLLQLLLLLLLRAEPLRSAELTFELPDNAKQCFHEEVEQGVKFSLDYQ
VITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYF
DFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLN
SRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPVNRAVHS
Download sequence
Identical sequences Q78IS1
NP_079636.2.92730 ENSMUSP00000058723 ENSMUSP00000058723 10090.ENSMUSP00000058723 ENSMUSP00000058723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]