SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000066393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000066393
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.72e-24
Family Canonical RBD 0.002
Further Details:      
 
Domain Number 2 Region: 119-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000244
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000066393
Sequence length 266
Comment (Mus musculus)
Sequence
MRSSARGRPLQAATAFFLSFFFLRRFERGFWLWGGDSETKVYVGNLGTGAGKGELERAFS
YYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFD
RPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRG
RRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGSRYFQSRSRSRSRSRSISRPRSSRSK
SRSPSPKRSRSPSGSPHRSASPERMD
Download sequence
Identical sequences 10090.ENSMUSP00000066393 ENSMUSP00000066393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]