SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000068285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000068285
Domain Number 1 Region: 228-276
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000314
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000068285
Domain Number - Region: 338-362
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 298-321
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00663
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000068285
Sequence length 541
Comment (Mus musculus)
Sequence
MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIHNANKEEGYEEKNCEN
SETVSSQPNQKNLIVLSDSEVIQLSDTSEVITLSDEDSIYRCKRKNIEVQAEEKTQSPAT
SHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEESTTSENENVESWMLLGSEE
DGKDNDILLNLVGCETAGAEDDVNWFISDKDIEAKIDNNRSSGRWNNRYYSVNKNVTCRN
CDKRGHLSKNCPLPQKVRACCLCSERGHLQYGCPARYCLDCSLPMSSNHRCFERLSWRKR
CDRCDMIGHHADACPEIWRQYHLTTKPGPPKKPKTPSGQSALVYCYNCAQKGHYGHECTE
RRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKDLKKNGDFPRQFKRPHVEETDKRRH
HDMRKSRSPRKYRRWPRENKETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCA
NNQKPSKSLHHASHYHRLREERLLRESKRSKPKKRKSTEDGSHDDLFLIKQKKKKPKPSG
L
Download sequence
Identical sequences B1AX39
NP_613056.2.92730 XP_006538047.1.92730 10090.ENSMUSP00000068285 ENSMUSP00000103454 ENSMUSP00000103454 ENSMUSP00000124542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]