SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000068677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000068677
Domain Number 1 Region: 123-156
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000785
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000068677
Domain Number - Region: 103-208
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.00157
Family Nickel-iron hydrogenase, small subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000068677
Sequence length 241
Comment (Mus musculus)
Sequence
GRGPTPPRQNEPAVCHRHERRLGVPASPATQLGLPVASGHTPSAFDAFRPEQLAFGKGRP
EQLGSPLHSSYLNSVFQLQRGEALSSSVYRNASPYGSLNNIADGLSSLTEHFSDLTLTSE
ARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWM
SGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRV
Q
Download sequence
Identical sequences 10090.ENSMUSP00000068677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]