SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000072107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000072107
Domain Number 1 Region: 16-372
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.75e-70
Family L-arabinose binding protein-like 0.0012
Further Details:      
 
Domain Number 2 Region: 392-506,625-765
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.04e-66
Family Phosphate binding protein-like 0.000000000978
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000072107
Domain Number - Region: 516-620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000902
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000072107
Sequence length 895
Comment (Mus musculus)
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNRDLFYINLYPDYAAISR
AVLDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGVMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGRITFNKTDGLRKDFDLDIISLKEEG
TEKIGIWNSNSGLNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDR
FEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTI
TYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLF
VIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGI
WWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKI
STYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLI
DSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSKEASALGVEN
IGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQKGKSSRLRFYFRNKVRFHGSKTESL
GVEKCLSFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQRKETVA
Download sequence
Identical sequences ENSMUSP00000072107 10090.ENSMUSP00000072107 ENSMUSP00000023652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]