SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000075689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000075689
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.34e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000075689
Domain Number - Region: 274-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000331
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000075689
Sequence length 653
Comment (Mus musculus)
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALN
PDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPASNPPPPSLMS
TTQSRPPWMNSGPSENRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPP
PPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGS
IPPWQQQQAAAAASPGTPQMQGNPTMVPLPPGVQPPLPPGAPPPPTCSIECLLCLLSSPN
SLCLSPNRAARIPPRGSDGPSHESEDFPRPLVTLPGRQPQQRPWWTGWFGKAA
Download sequence
Identical sequences 10090.ENSMUSP00000075689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]