SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000078361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000078361
Domain Number 1 Region: 28-98
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000198
Family Cold shock DNA-binding domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 146-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000112
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000078361
Sequence length 271
Comment (Mus musculus)
Sequence
MAEGGASKGEEPEKLPGLAEDEPQVLHGTGHCKWFNVRMGFGFISMISREGNPLDIPVDV
FVHQSKLFMEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPGGSPCLGSERRPKGKTLQKR
KPKGDRWRRQDLLMDQMWTVREEESRMIPRCYNCGGLDHHAKECSLPPQPKKCHYCQSIM
HMVANCPHKLAAQLPASSQGRQEAESQPCSSAAPREVGGGHGCTVLFPQEVKSEMAEHSD
RSPQEVSSTKAFAAIGEQNKKGPLIQKRKKT
Download sequence
Identical sequences ENSMUSP00000078361 NP_001026942.1.92730 XP_011241490.1.92730 10090.ENSMUSP00000078361 ENSMUSP00000078361 ENSMUSP00000078361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]