SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000095538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000095538
Domain Number 1 Region: 1110-1282
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.26e-47
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0088
Further Details:      
 
Domain Number 2 Region: 511-572,635-731
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.06e-40
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.069
Further Details:      
 
Domain Number 3 Region: 965-1106
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.6e-35
Family Poly(A) polymerase, PAP, N-terminal domain 0.021
Further Details:      
 
Domain Number 4 Region: 354-545
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.18e-28
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.058
Further Details:      
 
Domain Number 5 Region: 1302-1330
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000436
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number 6 Region: 1355-1382
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000095538
Domain Number - Region: 926-950
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000235
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Domain Number - Region: 1576-1636
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000462
Family Interferon regulatory factor 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000095538
Sequence length 1648
Comment (Mus musculus)
Sequence
MEEPKTSKNENHEPKKNIICEESKAVKIISNQTLKPRNDKSEIGTSSLNRNSSKKTKQND
ICIEKTEAKSCKVNAASVPGPKDLGLVHRDQSHCKMKKLPNSPMKAQKGSSQTKLEKTPS
LQTKAEKVPKSPNLPVKAEKAPCTTAEATTEKALNSQRKEENTPTSQMKLQKTPRSPLEP
ENVPSLLLKENVKQTESQQTGKKLTSSFVSMDKRKSEALQGEKSALENSSLSQKQQTQTD
NIADSDDSASGIEDTADDLSKMKSEESNKENSSEMDYLENATVIDESALTPEQRLGLKQA
EERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESE
LRSLPSPSSAHLAALSVAVVELAKEQGITDDDLRIRQDIVEEMSKVIMTFLPECSLRLYG
SSLTKFALKSSDVNIDIKFPPKMNHPDLLIQVLGILKKSALYIDVESDFHAKVPVVVCKD
RKSALLCRVSAGNDMACLTTDLLAALGKVEPVFTPLVLAFRYWAKLCYIDSQTDGGIPSY
CFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWEYNSSSATEK
NLIADENKAKADEPKDDTKKTETDNQSNAAKAKHGKSPLTLEAPNQVPLGQLWLELLKFY
TLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEYVVERF
RAAYRYFACPQKKGGNKSTMDPKKKEKGKLSSKKPVKSDCSATNCCILGESAEKIHMERG
QPAKHDETEFTSQRCIVDNDSLLVNELGLANHGQDSSSLSTASGGSDLKQKSAEKQGDLT
PSETSLKKELSQCICIGTPDGAESAGTDCRSNLEMDSSHQIVCNNVSATSCNCKATEVTS
DLVDEDNLPSQELYYVFDKFILTSGKPPTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPM
TNRFREILDLVCKRCFDELSPPCSEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGF
GFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHR
RSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYA
YILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLGKNTE
SLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGV
SRKMTNFIMKAFINGRKLFGTPFYPLIGREAEYFFDSRVLTDGELAPNDRCCRVCGKIGH
YMKDCPKRKSSLLFRLKKKDSEEEKEGNEEEKDSRDLLDSRDLRCFICGDAGHVRRECPE
VKMARQRNSSVAAAQLVRNLVNAQQVAGSAQQQSDQSIRTRQSSECSDSPSYSPQPQPFP
QNSPQPSALPPPPSQPGSQPKLGPPQQGGQPPHQVQMPLYNFPQSPPAHYSPMHSMGLLP
MHPLQIPAPSWPIHGPMLHSAPGSTPSNIGLNDPSIIFAQPAARPMAIPSPSHDGHWPRT
VAPNSLVNNGAVGNSEPRFRGLNPPIPWEHAPRHFPLVPASWPYGLHQNFMHQGNPRFQP
KPFYAQDRCATRRCRERCPHPPRGNVSE
Download sequence
Identical sequences A2A8R7
ENSMUSP00000095538 ENSMUSP00000095538 XP_017175628.1.92730 10090.ENSMUSP00000095538 ENSMUSP00000095538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]