SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000100284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000100284
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-32
Family V set domains (antibody variable domain-like) 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000100284
Sequence length 98
Comment (Mus musculus)
Sequence
EVQLQQSGPKVVNAGASVKLSCKSSGYSFSRYKMECVKQSHVKSLEWIEHINLFNGITNY
NGNFKSKATLTVDISSSTAYMELSRLTSEDSEVYYCAR
Download sequence
Identical sequences A0A075B5U1
10090.ENSMUSP00000100284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]