SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000100653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000100653
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily EF-hand 6.35e-28
Family S100 proteins 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000100653
Sequence length 96
Comment (Mus musculus)
Sequence
MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMK
KLDLNCDGQLDFQEFLNLIGSLAIACHDSFIQTSQK
Download sequence
Identical sequences 10090.ENSMUSP00000100653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]