SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000100767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000100767
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily Histone-fold 1.26e-28
Family Nucleosome core histones 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000100767
Sequence length 105
Comment (Mus musculus)
Sequence
MAKKMQRRRRQKRTRSQRGELPFSLVDRFLREEFHSSRLSSSALSFLTSVLEYLTSNILE
LAGEVAQTTGRKRIAPEDVRLVVQNNEQLRQLFKPGGTSVNEDDN
Download sequence
Identical sequences Q5M8Q2
ENSMUSP00000094245 ENSMUSP00000128649 ENSMUSP00000129155 ENSMUSP00000131550 ENSMUSP00000131730 ENSMUSP00000132146 ENSMUSP00000132813 ENSMUSP00000125841 ENSMUSP00000135929 ENSMUSP00000136695 ENSMUSP00000136794 ENSMUSP00000137030 ENSMUSP00000137575 ENSMUSP00000140925 ENSMUSP00000125841 ENSMUSP00000135929 ENSMUSP00000136695 ENSMUSP00000137030 ENSMUSP00000137043 ENSMUSP00000137166 ENSMUSP00000137575 10090.ENSMUSP00000100762 10090.ENSMUSP00000100763 10090.ENSMUSP00000100764 10090.ENSMUSP00000100765 10090.ENSMUSP00000100766 10090.ENSMUSP00000100767 10090.ENSMUSP00000100768 NP_001104507.1.92730 NP_001229878.1.92730 NP_001229879.1.92730 NP_001229880.1.92730 NP_001229881.1.92730 NP_001229882.1.92730 NP_001229883.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]