SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000104534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000104534
Domain Number 1 Region: 103-223
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000172
Family PX domain 0.0047
Further Details:      
 
Domain Number 2 Region: 304-358
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000255
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 902-932
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000471
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000104534
Sequence length 1022
Comment (Mus musculus)
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLNSGGGGGGGGGGGGKSAPGPSGALPTCSACHKM
APRTETPVSSISNSLENALHTSAHSTEESLPKRPLGKHGKVSVEKIDLKGLSHTKNDRSV
ECSFEVLWSDSSITSVTKSSSEVTEFISKLSQLCPEENLDKLIPCLAGPDSFYVERNHVD
LEAGLRFLASAPSHTLKHDHVRKFFSSSSPSQQLQSPSPGNPSLPKVGAVMGVSGRPVCG
VAGIPSSQSSAQHHLQHSASTSASLPHCSHTGGTGSALAYRTQVDNSPTILMPSSLQTPQ
PQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELE
KEKSERRCLNSSAPSLVTSSGVARVTPTSHVGPVQPGRSSSHASELRVEVEPPAHQLPRE
GSSSEYSSSSSSPMGVQVREESSDSAEESDRRVDIHVEGTEKEKPVMLLAHFPSSSARPT
AQVLPVQNETGSSPAAHHPLPPQLMPAASHLAPVRMLNSVHKSDRGGADVKLLSSSVHSL
LSLEERNKGPGPRSGTKVDKSFGGAVLDPLPSAAPHPPGQGLSGLVENNAVSPTVSFGPR
AKVVHAATLDRVLKTAQQPALTVESSSATTGTPSTVLHVARPPIKLLLASSVPADAAIAG
QTSCPNNGQISVPPAIMNPRTALYTANTKVAFSAVSSVPVGPLQGSFCANSNTASPSSHP
STSFASMASLPSCPAPSSSPALSSVPESSFYSGGAGSSSPGNIPASSQSHHHHHHHQQPP
APPQPAPPPPGCIVCTSCGCSGSCGSNGLTVSYANYFQHPFSGPSVLTFPFLPFSPMCGN
GYVSTQQYGGGSAFPVVHTPYNGSVTPDPVLGGQSTFAVPPMQNFMAGTAGVYQAQGLVG
STNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGKQVRGSHVLLALWLVAPERRK
QETCFVLFFKMIFIHTVFFFFFFKIYLFIIICTYTVAVFRCTRRGCQTSSRVVVSHHVVA
GI
Download sequence
Identical sequences 10090.ENSMUSP00000104534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]