SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105422 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000105422
Domain Number 1 Region: 509-842
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-49
Family Tandem AAA-ATPase domain 0.00037
Further Details:      
 
Domain Number 2 Region: 375-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000236
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105422
Sequence length 1266
Comment (Mus musculus)
Sequence
MERLATVRARLQEWERAFARLHGRRPAKGDVEAAPEETRALYREYRNLKQAVRQADDRHR
VLEQSLAEAAEEAQEPSCWGPHLSRAATQNTQSMPKQSLLSSVQDYGKRLKANLKNTTQT
GPTQSRKLQLQKRSLSTVPAPRPPGSKTESPCPDEADDALPRVPEPRPRLGQLQQLRSSL
SRRLTSLDPGWLERCHNRVSDLLEVPGACGLDLSAEESQPQMSGKVNIADPDIQSEVSVQ
SPEAIAQQPAQVLSQSPKSINSKGRKRKWNEKGEDFAQDQPSSGAGPLSEGARATVHGQD
PPGEPTQVNVPQPCNSSNQARTEKAKGTTHLHASPRPASLDRGNYIRLNMKNKRFVRVGA
NRGRLLRKQVWKQKWKKKQAAFGGSGPRATDKDTCFRCGQFGHWASQCSQPGPTLTVQEE
GDRDDKQPISTLEEVAQRTGTASCHHSGEETQPAAPELQVPHCPTPMSPLYPPGPLGQVA
ETPAEVFQALERLGYRAFRPGQERAIMRILSGISTLLVLPTGAGKSLCYQLPALLYAQRS
PCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTKKQRESVLKKVRAAQVHVLIVSPEA
LVGCGARGPGSLPQAAQLPPIAFACIDEVHCLSQWSHNFRPCYLRVCKVLREHMGVRCFL
GLTATATRSTARDVAQHLGIAGEFELSGSANIPANLHLSVSMDRDSDQALVTLLQGDRFR
TLDSVIIYCTRRKDTERVAALLRTCLSMVGDSRPRGCGPEAIAEAYHAGMSSQERRRVQQ
AFMRGHLRMVVATVAFGMGLDRPDVRAVLHLGLPPSFESYVQAIGRAGRDGKPAHCHLFM
HPQVGSPISPDQDRPRGSTIPRPLQPQLLSCLPVSCRPGPKCGSSVHMTVPMQGEDLWEL
RRHAHADSTDFLAVKRLVQRVFPPCTCSQRPVSKSSPEEVKEHSGQQTYPVLGQACLGHE
RALPVQSTVQALDMTEEAIETLLCYLELHPRHWLELLPWTYAQCHLHCLGGSAQLQALAH
RCPPLAACQAKWPPKDTSQGRSSLEFGVVELADSMGWKLASVRQALHQLKWDPEPKKGAA
QGTGVLVKFSELAFHLHSRGDLTDEEKDQICDFLYNRVQAREHKALAHLHQMSKAFRSVA
FPSCGPCLEQSNEEHSNQVKTLVSYYFEEEEEEEETMTDTQGPKPGQTQLQDWEDQIRRD
VRQLLSLRPEERFSGRAVARIFHGIASPCYPAQVYGLDRRFWRKYLHLDFHALMHLATEE
LLLRGR
Download sequence
Identical sequences ENSMUSP00000105422 XP_006521610.1.92730 10090.ENSMUSP00000105422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]