SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000106369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000106369
Domain Number - Region: 34-60
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00398
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000106369
Sequence length 429
Comment (Mus musculus)
Sequence
MESQIKGLPAVPAQTAQGEPRSSWEQTLPSLKKENHMVKCRNCGGFGHNVRSRMCPMKQG
HVLLVSQPLGARKEKENGDPCRPHGLQKLSQDTRQRFDEQQRKAPFQKFPMKPQKGDQQV
NLAQPRMPSIPGIRKRSASPVKTSLGKQMCPGKPVLQCFDSSYILHSRQKEGRRMAVAGV
AKLVLRQDGRNSASEELLDQKGTSCQHPVAVPKSNASSELFHKEPKAQGPSRKTQPSQHP
VIHQNRQNPKLSFGAPGKEASWCPTQPSQNPLKKQRLNSTDAPEKSHARTGSKGTLDSQS
PPIANRLGLKGANEMSKKITAQDPSTDQQQLYSRAALFATRPCIEFHRASAGRVADQALR
MIFTRHGSNCWSSRFLSVPPPLPLEKQTPPSESPTFPEEGEVAGSQVKVSILYEDLQVSS
SSSENSDGE
Download sequence
Identical sequences A2A4E2
NP_001075131.1.92730 ENSMUSP00000106369 ENSMUSP00000106369 ENSMUSP00000106369 10090.ENSMUSP00000106369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]