SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000113185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000113185
Domain Number 1 Region: 555-582,626-706
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-16
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000113185
Sequence length 720
Comment (Mus musculus)
Sequence
MVFTGEQISQRAWCDRMDASPEPQQKGGTLVLVRRQPPVSQGLLETLKARLKKSCTCSMP
CAQALVQGLFPAIHWLPQYRLKEYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYT
SFFANLIYFLMGTSRHVNVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPKNNDSTLNN
SATTLIIGLQDCRRDCYAIRVATALTLMAGLYQVLMGILRLGFVSTYLSQPLLDGFAMGA
SVTILTSQAKHMLGVQIPRHQGLGMVVHTWLSLLQNVGQANICDVVTSALCLGVLLAAKE
LSDRYRHRLKVPIPTELFVIVVATIVSHFGQLHTRFDSRVAGNIPTGFVAPQVPDPKIMW
RVALDAMSLALVGSAFSISLAEMFARSHGYSVSANQELLAVGCCNVLPAFFHCFATSAAL
SKTLVKIATGCQTQLSSVVSAAVVLLVLLVLAPLFHDLQRCVLACIIVVSLRGALRKVKD
LPQLWRLSPADALVWVATAATCVLVSTEAGLLAGVFFSLLSLAGRTQRPRAALLARIGDS
TFYEDAAEFEGLLPPPEVRVFRFTGPLYYANKDFFLRSLYRLTGLDAGHSATRKDQGPEV
GVSNRSLVDGKDLGSVSSGAGLVVPLAFGFHTVVIDCAPLLFLDVAGMATLKDLRRDYRA
LDITLLLACCSPSVRDTLRKGGFLGEEQGAENELLFPSVHSAVEAACARREELLAADSAL
Download sequence
Identical sequences G5E8U1
ENSMUSP00000113185 NP_001297620.1.92730 10090.ENSMUSP00000113185 ENSMUSP00000113185 ENSMUSP00000113185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]