SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000114238 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000114238
Domain Number 1 Region: 207-263
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-16
Family SH3-domain 0.0003
Further Details:      
 
Domain Number 2 Region: 67-154
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-16
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000114238
Sequence length 269
Comment (Mus musculus)
Sequence
XQVALQAYSTVKTVPLPVLGISEIQSRVLEEVHSLTFVKENSATFIERKLSFEKKKPAQI
LPEVPHQTDAHRSKLLSTYGAEELYRAKRKCNATQEHDINLLEGELVAVLEQKDPLGSTS
RWFVDTGCVKGYVYSSFLKPHNPGKGQKVDADNRFCDDDFENISLFVSCRPAGDRVSISD
SSSSLSGSCGKFETNGADADNFQEVDEQIFYAVHAFQARSDHELSLQEYQRVHILRFCDL
SGNKEWWLAEAQGQKGYVPANYLGKMTYA
Download sequence
Identical sequences 10090.ENSMUSP00000114238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]