SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000000432 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000000432
Domain Number 1 Region: 40-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-21
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000000432
Sequence length 149
Comment (Rattus norvegicus)
Sequence
MKSACKPHGPPAGARGAPPCAGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTA
FDRLRRVVPQWGQDKKLSKYETLQMALSYIVALTRILAEAERDWVGLRCEQRGRNHPYLP
FPGARLQVDPEPYGQKFFGFQPESFPMAS
Download sequence
Identical sequences D3ZG53
ENSRNOP00000000432 ENSRNOP00000000432 10116.ENSRNOP00000000432 NP_001163953.1.100692 NP_001163953.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]