SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000001668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000001668
Domain Number - Region: 227-249
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000398
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number - Region: 51-119
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00209
Family Mitotic arrest deficient-like 1, Mad1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000001668
Sequence length 695
Comment (Rattus norvegicus)
Sequence
MAAGVDFGDLELFEAFDPQEESTPKPVHTRFKDDEEEDDDDDENGVGDAELQEQLRRCEE
TIEQLRAENQELKRKLNILTRPSGILVSNTKIDGPLLQILFMNNAISKQYHQEIEEFVSN
LVKRFEEQQKNDVEKTSFSLLPQPSSVMLEEDRKVEESCAIKNNKEAFSVVGSVLYFTNF
CLDKLGQPLLNENPQLTEGWEIPKYQQVFSHIVSLEGQEMQVKAKRPKPHCFNCGSEEHQ
MKECPMPRNAARISEKRKEYMDACGEANSQSFQQRYHAEEVEERFGRFKPGVISEELQDA
LGVTDKSLPPFIYRMRQLGYPPGWLKEAELETSGLALYDGNDDADGETETGEIQNKNVTY
DLSKLVNYPGFNISTPRGIPDEWRMFGSIPMQACQQKDVFASYLNSNIQSPSVKSSSKRS
SSQSSPNSPKKQRREGSAAASPADMELDSDIEIPPGSQSSKAFQFQPPLPPGTPPPLPQG
TPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDEDALTLEELEEQQRQIWAALQQAEGAN
SDSDVPMDTPLTGNSVASSPCPNEFDLRVPEGRALEKPVLAEPDTASPEPSCSPAAEAAV
LSQKEEGVSAEGDPGDGLLDNGGVLNISNGGNHLDTRPPTASKTHSPVPDMSKFAHGITP
FEFENMAESTGMYLRIRNLLKNSPRNQQKNKKTSE
Download sequence
Identical sequences D3ZUL8
ENSRNOP00000001668 XP_006249395.1.100692 10116.ENSRNOP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]