SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000003870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000003870
Domain Number 1 Region: 347-473
Classification Level Classification E-value
Superfamily PX domain 6.98e-17
Family PX domain 0.0064
Further Details:      
 
Domain Number 2 Region: 1110-1138
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000488
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000003870
Domain Number - Region: 43-48
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000003870
Sequence length 1168
Comment (Rattus norvegicus)
Sequence
MLRMKLPPKSTHPSEPPPDAEEPEADARPGAKAPPRRRRDCRPPPPPPTGLPRGPPPPPP
SPPRGLEPPVASGPTAGAGMPGGGGHAAALREQERVYEWFGLVLGSAQRLEFLCGLLDLC
NPLELRFLGSCLEDLARKDYHYLRDSEAKANGLSDPGSLADFREPAVRSRLIVYLALLGS
ENREAAGRLHRLLPQVDAVLRSLRATRVEGSRGSVEDEPGGDDEQDAEKDGPGPEGGGCA
KLGTGGGLGFRAQEELLLLFTMASLHPAFSFHQRVTLREHLERLRSALRVEPEDAEVEPS
NFAGSRAQNDSACGDYIQSNETGLVEQAQIPQDGLTVAPHRAQREAVHIEKIMLKGVQRR
RADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKEFSSESFDKTILKALNQGSLRR
EERRHPDLEPILRQLFSTSPQAFLQSHKVRSFFRSISSESQHSFNNLQSSLKTSKILEHL
KEDSSEASSQEEDVLQHTIIHKKHAGKSPAGNVATSCALLEGLTMQYAEQNGVVDWRNQG
CAAIQHSEHCVSSADQLSAEKRSLSSVNKKKGKPQVEKEKIKKTENRLSSRINGIRLSAP
QHAHGSTVKDMNLDVGSGHDTCGETSSESYSSPSSPRHDGRESLESEEEKDRDTDSNSED
SGNPSSARFAGHGSVTQTVSVQPPADTVSLGTENGNLLEAPLTSHKYPHIPFMPTLPCVM
HNGAQKSEVVIPSPKSADGKAVGVLVPNPVAISTMMESTNAAPVGILGPAASGESEKHLE
LLASPLPIPSPFLPHSSAPALQLTLQSLKLQPPQGASENCPVNIPQQAATRLSIGSPNTA
LIPVHNPGAFPGSPVAATDPITKSASQVVGLNQMVPQIEGNTGTVPQPNNVKVVLPAAGL
SAAQPPASYTFPGSPLAASVLPTQNSTVLNTATSAQPASTGISPAQSTVPPAVPTHTPGP
APSPSPALTHSTAQSDSTSYISAVGNTNANSTIVPPQPLGPCGSCGRRCSCGTNGNLQLN
SYYYPNPMPGPMYRLPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPYANGLVHDPVM
GSQASYGMQQMAGFGRLYPVYPAPNVVANTSGSGPKKNGSVSCYNCGVSGHYAQDCKQSS
MEANQQGTYRLRYAPPLPPSNDTLDSAD
Download sequence
Identical sequences Q498S6
ENSRNOP00000003870 10116.ENSRNOP00000003870 XP_006249687.1.100692 XP_006249688.1.100692 ENSRNOP00000003870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]