SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000006357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000006357
Domain Number 1 Region: 177-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000523
Family Growth factor receptor domain 0.0064
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000006357
Domain Number - Region: 143-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0446
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000006357
Sequence length 349
Comment (Rattus norvegicus)
Sequence
MHLLLAAGFGLLLLLLPPPAASKKPTQCQRCRTLVDKFNQGMANTARKNFGGGNTAWEEK
TLSKYEFSEIRLLEIMEGLCDSSDFECNQLLEQQEEQLEAWWQSLKKDYPNLFEWFCVRT
LKACCLPGTYGPDCKECQGGSERPCSGNGYCSGDGSRQGDGSCQCHAGYKGPLCIDCMDG
YFSLQRNETHSICLACDESCKTCSGPSNKDCVQCEVGWARVEDACVDVDECAAETPPCSE
AQYCENVNGSYICEECDSTCVGCTGKGPANCKECIAGYTKQSGQCADIDECSLEEKACKR
RNENCYNVPGSFVCVCPDGFEETEDACVQTAQSEVTEENPTQPLSHEDL
Download sequence
Identical sequences Q4G063
NP_001032285.1.100692 NP_001032285.1.4139 10116.ENSRNOP00000006357 ENSRNOP00000006357 ENSRNOP00000006357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]