SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000006780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000006780
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.34e-28
Family Canonical RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 95-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000119
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000006780
Sequence length 217
Comment (Rattus norvegicus)
Sequence
MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLD
KDSALNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYAC
PKNMLGEREPPKKKEKKKKKKVPEPEEEIEEVEVSEEEGEDPALDSLSQAIAFQQAKIEE
EQNKWRPSTGGPSTSDDSRRPRIKKSAYFSDEEELSD
Download sequence
Identical sequences Q499V6
NP_001030112.1.100692 NP_001030112.1.4139 10116.ENSRNOP00000006780 ENSRNOP00000006780 ENSRNOP00000006780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]