SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000007335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000007335
Domain Number 1 Region: 169-365
Classification Level Classification E-value
Superfamily E set domains 2.05e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000113
Further Details:      
 
Domain Number 2 Region: 64-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.27e-20
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000007335
Sequence length 501
Comment (Rattus norvegicus)
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
PTRMEGNLPAKLRKMNSDRFT
Download sequence
Identical sequences P63250 P63251 Q3ZAT1
ENSMUSP00000063329 10090.ENSMUSP00000063329 10116.ENSRNOP00000007335 ENSMUSP00000063329 ENSMUSP00000108252 ENSMUSP00000063329 NP_032452.1.92730 NP_113798.1.100692 NP_113798.1.4139 XP_006497793.1.92730 ENSRNOP00000007335 W00236 ENSRNOP00000007335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]