SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000010350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000010350
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000569
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000010350
Sequence length 780
Comment (Rattus norvegicus)
Sequence
MAARDRRSEPPQLAEYSCSYAVSRPVYSELAFQQQRERRLPERRTLRDSLARSCSCSRKR
AFGALKALLPILDWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVQYGLYSA
FFPILTYFVFGTSRHISVGPFPVVSLMVGSVVLSMAPDDHFLVPSGNGSTLNTTTLDTGT
RDAARVLLASTLTLLVGIIQLVFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLIEIFQNIGDTNIADFIAGLLTIIVCMAVKELNDRFKHKIPVPI
PIEVIVTIIATAISYGANLEANYNAGIVKSIPSGFLPPVLPSVGLFSDMLAASFSIAVVA
YAIAVSVGKVYATKHDYIIDGNQEFIAFGISNVFSGFFSCFVATTALSRTAVQESTGGKT
QVAGLISAVIVMVAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWKQNKTDAV
IWVFTCIMSIILGLDLGLLAGLLFGLLTVVLRVQFPSWNGLGSVPSTDIYKSITHYKNLE
EPEGVKILRFSSPIFYGNVDGFKKCVKSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRAT
KNGIISDVGSSNNAFEPDEDVEEPEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFALLQDDVLEKMEQCGFFDDNIRKDRFFL
TVHDAILYLQNQAKSREGQDSLLETITLIQDCKDPLELMEAEINEEELDVQDEAMRRLAS
Download sequence
Identical sequences Q9R154
ENSRNOP00000010350 10116.ENSRNOP00000010350 ENSRNOP00000010350 NP_062087.1.100692 NP_062087.1.4139 XP_008762798.1.100692 XP_017449543.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]