SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000013884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000013884
Domain Number 1 Region: 137-175
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000276
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 2 Region: 94-136
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000314
Family Retrovirus zinc finger-like domains 0.00097
Further Details:      
 
Domain Number 3 Region: 52-93
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000652
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 4 Region: 2-27
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000314
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000013884
Sequence length 179
Comment (Rattus norvegicus)
Sequence
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGES
GHLAKDCDLQEDVEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQK
CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Download sequence
Identical sequences A0A1U7TXH5 A0A2J8KAH6 A0A2J8TVK9 E2RPD7 G1M9Z3 G7N7U7 G7PIN4
ENSRNOP00000013884 ENSCAFP00000006421 ENSAMEP00000016166 ENSPTRP00000026477 ENSAMEP00000016166 NP_001120664.1.87134 NP_001120664.1.92137 XP_004368438.1.4749 XP_004613181.1.94378 XP_004645655.1.9945 XP_004702416.1.18182 XP_006870540.1.41390 XP_006901415.1.29581 XP_007465344.1.90284 XP_008064669.1.4292 XP_008157437.1.99482 XP_012924747.1.39548 XP_015973909.1.101085 XP_021550561.1.83697 ENSP00000410769 ENSPTRP00000026477 ENSP00000426223 ENSCAFP00000006421 10116.ENSRNOP00000013884 9606.ENSP00000303844 ENSGGOP00000009839 ENSP00000410769 ENSNLEP00000017627 gi|187608726|ref|NP_001120664.1| ENSGGOP00000009839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]