SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000016350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000016350
Domain Number - Region: 252-282
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00131
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000016350
Sequence length 951
Comment (Rattus norvegicus)
Sequence
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPKPCALCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
FIFLRLNVLREYLERELTMASLPFPFDVERSIDDWVFMCFFVGNDFLPHLPSLEIREGAI
DRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE
KRKRMKRDQPAFTPSGILTPYALGSRNSPGCQVASNPRQAAYEMRMQSNSSPSISPNTSF
ASDGSPSPLGGLKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQ
SYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSEFEKGTKPFKPLEQLMG
VFPAASGNFLPPTWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRA
ALEEVYPDLTPEENRRNSLGSDVLFVGKVHPLHDFILELYQTGSTEPVDVPPELCHGIQG
KFSLDEEAILPDQTVCSPVPMLRDLTQNTAISINFKDPQFAEDYVFKAIMLPGARKPAAV
LKPGDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVIPRGSGTGVYSNTAPPPAN
YQGNVYRPLLRGQAQIPKLMSNMRPQDNWRGPPPLFQQQRFDRSVGAEPLLPWNRMLQTQ
NAAFQPNQYQMLAGPGGYPPRRDDHRGGRQGYPREGRKYPLPPPSGRYSWN
Download sequence
Identical sequences D4A914
ENSRNOP00000016350 10116.ENSRNOP00000016350 XP_006235218.1.100692 XP_017458114.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]