SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000016899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000016899
Domain Number 1 Region: 351-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000345
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000016899
Domain Number - Region: 591-667
Classification Level Classification E-value
Superfamily EF-hand 0.000165
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000016899
Sequence length 763
Comment (Rattus norvegicus)
Sequence
MNIMENSKEQELQTLGSRVWDNPAYSSPPSPNGTPRICTVSSVALPETQPKKPEVRRQEK
TPRVPVSGCCLLICRGIRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDVCLLTYG
MTSSSAYYYTKVMSELFLHTPSESAVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSL
GSSSHSFIYYENLLLGVPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPL
NGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRV
VFIDFSVYNANINLFCILRLVVEFPATGGAIPSWQIRTVKLIRYVNNWDFFIVGCEVIFC
IFIFYYVVEEILEIRVHRFRYLSSVWNILDLVVILLSIVAVGFHVFRTLEVNRLMGELLQ
QPDTYPDFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AIMFFIVFFAYAQLGYLLFGTQVESFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVY
FITYVFFVFFVLLNMFLAIINDTYSEVKEELAGQRDQLQLSDLLKQSYSKTLQRLRLRKE
RVSDVQKVLKGGEPEIQFEDFTNTLRELGHAEREISEVSAAFTRFDRDGDHILDEEDQAQ
MRQGLEEERMTLSAETENLGRSVGHSPPGELDAEAARGRSWVSGEEFDMLTRRVLQLQRV
LEGVVSQVDALSSKLKMLERKGELAPSPGMAMPAVWENPYNPS
Download sequence
Identical sequences 10116.ENSRNOP00000016899 ENSRNOP00000062794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]