SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000017707 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000017707
Domain Number 1 Region: 202-249
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000105
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000017707
Domain Number - Region: 310-334
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000166
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 267-293
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000963
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000017707
Sequence length 512
Comment (Rattus norvegicus)
Sequence
GFQLTAQVHYPQNIHNANEEEGYEEKNCESSETVSIQPDQKNLIVLSDSEVIQLSDTSEV
ITLSDEDSIYRCKRKNIEVQAQEKTQSPATPRSNKVANKCKRSNKKPEPEESPSTIREVM
IIEVSSDEEEESTISENENVESWMLLGCEEDDKDNDILLNLVGCKDAGAEGENDVNWFIS
DKDIEAKIDNNRSSGRWNNRYYSVNKNVTCRNCDKRGHLSKNCPLPQKVRPCCLCSERGH
LQYGCPARYCLDCSLPMSSTHRCFERSSWRKRCDRCDMIGHYADACPEIWRQYHLTTKPG
PPKKPKTPSGQSALVYCYNCAQKGHYGHECTERRMFNQAFPTSPFIYCYDDKYDIQQRDR
RIKRKLKDIKKNGDFPRQFKRPHGEETDRYHHDRRKSRFSGKRSRWPRESKETQKEKTRG
REGEKHRRDRQPRDEDEDFPRGLKPNSSSSSNSQKPSKSLHQASHYHRLREEKLRRESMR
SKPKKRKFVEDGSHDDLFLIKQRKKKPKSSGF
Download sequence
Identical sequences ENSRNOP00000017707 10116.ENSRNOP00000017707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]