SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000018114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000018114
Domain Number 1 Region: 164-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-68
Family Tandem AAA-ATPase domain 0.0000502
Further Details:      
 
Domain Number 2 Region: 339-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-52
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000018114
Domain Number - Region: 578-603
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000152
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000018114
Sequence length 622
Comment (Rattus norvegicus)
Sequence
MEESEPERKRARTNEATAGGSRSEDEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAE
EEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESV
AEGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPI
KSFKEMKLPAAILRGLKKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVI
MFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGG
MSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRT
IFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK
MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFRE
GKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKAC
DESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEA
MQTKQVSNIGRKDYLAHSSMDF
Download sequence
Identical sequences B2RYL8
NP_001101516.1.100692 NP_001101516.1.4139 ENSRNOP00000018114 10116.ENSRNOP00000018114 ENSRNOP00000018114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]