SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000020111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000020111
Domain Number 1 Region: 179-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000419
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Domain Number 2 Region: 123-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000068
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000020111
Sequence length 271
Comment (Rattus norvegicus)
Sequence
MTRWARVTTSNSKRPLSATSWEDMKKGSAEGANQNPSNHKRCQVSGLSLRNDAPQAKHKK
NKKKKEYLNEDVNGFMEYLKQSSQVLHNGQLIAADSREVREEIAVALKKDSRREGRRLKR
QAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMTKCRANVDPALGE
FPFAKCFVCGEMGHLSRSCPDNTKGVYADGGGCKLCGSVEHFKKDCPENQNSDRIITVGR
WAKGMSADHEDVLDVPKPQKPKTKVPKVVNF
Download sequence
Identical sequences Q5XII6
ENSRNOP00000020217 10116.ENSRNOP00000020111 ENSRNOP00000020111 NP_001013174.1.100692 NP_001013174.1.4139 XP_006231903.1.100692 XP_017446309.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]