SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000022997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000022997
Domain Number 1 Region: 407-435
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000628
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000022997
Sequence length 465
Comment (Rattus norvegicus)
Sequence
MPLNLLQDWCRGEHLNIQRSMLILGIPEDCTEDEFEETLHEALKHLGRYRIIGRMFRREE
NAQAFLVELARDFDYALVPREIEGKGGPWEVVVKPPNSDDEFLNRLNHFLEEERRTVSDM
NRVLGTHSNYSPTKTAISADFWAWAQTLGAVMQPLLEQMLYRELRVFSGNTISIPGLLAF
DSWLEHTTEMLQMWQVPEVEKRRRLMECLRGPALQVVNVLRANNAAITVKECLEALRQVF
GSVENRKIAQLKFCKAYQEPGEKVSSFVVRLETLLQKALEKNAISRKNVNQTRLKRILGG
AILSAKLREKLKMLKQRRRPPGFLALVKLFREEEEEWEATRGPERSCSEGFELGPSSANI
GGRERALFVPDFGSVLEARPYQGSRRRRRRRGQHRRGGVPRDGSQGTRKQNYDTFCYSCG
EDGHIRVNCFNPSNRTLVKQKRQAAMEKGNRSWAWEKSHPKPKTK
Download sequence
Identical sequences D3Z8Y9
ENSRNOP00000022997 10116.ENSRNOP00000022997 NP_001099812.1.100692 NP_001099812.1.4139 XP_006229575.1.100692 ENSRNOP00000022997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]