SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000024374 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000024374
Domain Number 1 Region: 572-602,641-719
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000024374
Sequence length 739
Comment (Rattus norvegicus)
Sequence
MSSENKEQHNLSPRDLPEEAYGFPPELPLGAQRGSSTDLRQFEPSDRRRAFRRIHMELHE
KPDTNIRQLVMRKLQKSCQCNATKIRNRIFDFFPVLRWLPKYDLKKNILGDMMSGLIVGI
LLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVGIFGILCLMIGEVVDREL
HKACPDIDTTSSSIAMFSNGCVVVNHTLDGLCDKSCYAIKIGSTVTFMAGVYQVAMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSNGVGSVITTWIHIFRNIHKT
NICDLITSLLCLLVLVPTKELNEYFKSKLPAPIPTELIVVVAATLASHFGKLNENYNSSI
AGQIPTGFMPPQAPDWSLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTSLVLLLVLLLIAPLFYSLQK
CVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMF
CVILRTQMPKISLLGLEEESEIFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALY
KKTLNPVLVKAAWKKAAKRKLKEETVTFHGDPDEVSMQLSHDPLELHTVVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLAKGEYCKKEEENLLFYSLSEAVAFAE
ESQKEKGVCVVNGLSLSGD
Download sequence
Identical sequences O70531
ENSRNOP00000024374 NP_476468.1.100692 NP_476468.1.4139 XP_006254849.1.100692 XP_006254850.1.100692 XP_017456324.1.100692 ENSRNOP00000024374 10116.ENSRNOP00000024374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]