SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000025302 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000025302
Domain Number - Region: 123-147
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00544
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000025302
Sequence length 453
Comment (Rattus norvegicus)
Sequence
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGVKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQAKVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSG
FALKRNVLGRNLTANDPSQDYVASDGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKK
KSDKKKKKLQKSKNKHKKHKKSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSETDSSSESD
NKEKKEKEKRKKRKKTKCSGNKSGDCKEYKSKNMLYEELSSSHSDRGKAQEKLRLLKQES
SGENSTWVHSGSDRKSRSHQHSPERKGSDRNGGSRSRSRAEGSRRSRSRSPCGQKHRERE
ARSRPHQSPSEEQKGRKGTRSHGDSEHRRERAR
Download sequence
Identical sequences ENSRNOP00000060978 10116.ENSRNOP00000025302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]