SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000026737 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000026737
Domain Number 1 Region: 173-198,256-463
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.93e-58
Family Voltage-gated potassium channels 0.00062
Further Details:      
 
Domain Number 2 Region: 41-137
Classification Level Classification E-value
Superfamily POZ domain 7.06e-26
Family Tetramerization domain of potassium channels 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000026737
Sequence length 530
Comment (Rattus norvegicus)
Sequence
MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVINISGLRYETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFMEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRADGRGGSNEGSGTRMSPASRGSHEEEDEDEDSYAFPGSIP
SGGLGTGGTSSFSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKAAFFRNIMNII
DLVAIFPYFITLGTELVQRHEQQPVSGGSGQNGQQAMSLAILRVIRLVRVFRIFKLSRHS
KGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVT
MTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTH
VTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV
Download sequence
Identical sequences G3V8L6
ENSRNOP00000026737 NP_076444.1.100692 NP_076444.1.4139 ENSRNOP00000067348 10116.ENSRNOP00000026737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]