SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000030200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000030200
Domain Number 1 Region: 11-42
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000192
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number 2 Region: 58-86
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000593
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000030200
Domain Number - Region: 280-342
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0326
Family Interferon regulatory factor 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000030200
Sequence length 354
Comment (Rattus norvegicus)
Sequence
EYFFDSRVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKRLKKKDSEEEKEGNEEEKDSRD
LLDSRDLRCFICGDAGHVRRECPEVKMARQRNSSVAAAQLVRNLVNAQQVAGSAQQQSDQ
SIRTRQSSECSDSPSYSPQPQPFPQNSPQPSALPPPPSQPGSQPKLGPPQQGGQPPHQVQ
MPLYNFPPSPPAHYSPMHGMGLLPMHPLQIPAPSWPIHGPMLHSAPGSTPSNIGLNDPSI
IFAQPAARPMAIPSSSHDGHWPRTVAPNSLVNNGAVGNSEPRFRGLNPPIPWEHAPRPHF
PLVPASWPYGLHQNFMHQGNPRFQPKPFYAQAERCATRRSRERCPHPPRGNVSE
Download sequence
Identical sequences ENSRNOP00000030200 10116.ENSRNOP00000030200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]