SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000031039 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000031039
Domain Number 1 Region: 133-182
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 253-304
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 73-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 185-245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 5 Region: 307-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 6 Region: 372-411
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000031039
Sequence length 465
Comment (Rattus norvegicus)
Sequence
MPVGMQAPQWLLLLLLILPTTGSDPVLCFTQYEEPSGRCKGLLGRDIRVEDCCLNTAYAF
QEHDGGLCQSCRSPQWSAWSSWGPCSVTCSEGSQLRHRRCVGRGGQCSEKAAPGTLEWQL
QACEDQLCCPEMGGWSEWGPWGPCSVTCSKGTQTRQRLCDNPAPKCGGHCPGEAQQSQAC
DTQKICPTHGAWASWGPWSACSGSCLGGAQEPKETRSRSCSAPAPSHQPPGKPCSGTAYE
HRGCSGLPPCPVAGGWGPWGPSSPCPVTCGLGQTLERRTCDHPVPRHGGPFCAGDATRKH
VCNTAMPCPVNGEWEAWGKWSHCSRVRMKSISCDEIPGQQSRSRSCGGRKFDGQPCTGKL
QDIRHCYDIHNCVLKGSWSQWSTWGLCTPPCGPNPTRVRQRLCTPLLPKYSPTVSMVEGQ
GEKNVTFWGIPRPLCEVLQGQKLVVEEKRPCLHVPSCRDPEEKKP
Download sequence
Identical sequences B0BNN4
ENSRNOP00000031039 10116.ENSRNOP00000031039 ENSRNOP00000031039 NP_001100227.1.100692 NP_001100227.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]