SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000032067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000032067
Domain Number 1 Region: 118-358
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.43e-96
Family Enolase 0.0000000124
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.48e-38
Family Enolase N-terminal domain-like 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000032067
Sequence length 358
Comment (Rattus norvegicus)
Sequence
TTKGLFCAAVPSSASTGIYEALELQDNDMTRFMGKGVSKAVQHINITIASALVSKKLNVV
EQEKIDQLMIKMDGMESKSKFGTNAILGVSLAVCKAGAVEKGVPLYCHIADLAGNPEVIL
PIPVFNVINGGSHAGNKLTMQEYMILPVGASSFQEAMRIGAEVYHNLKNVIKEKYRKDAT
NVSDDGGFTPNILENKEALELLKSAITKASYTDQVVISMDVAASEFYRAGKYDLDFKSPD
DASWYITPNQLADLYKSFIKDYPVVSIEDPIDQDNYKFTATAGILVVGDDLTVTNPKRIA
KAVGEKSCNCLLLKVNQIGLTESLQACKLVQSNGWGVMVSRQSGETEDTFIANLVVGL
Download sequence
Identical sequences ENSRNOP00000032067 ENSRNOP00000032067 10116.ENSRNOP00000032067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]