SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000032971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000032971
Domain Number 1 Region: 413-527,647-793
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.15e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 22-389
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.08e-55
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Domain Number 3 Region: 543-646
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000267
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000032971
Domain Number - Region: 801-831
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0348
Family Phosphate binding protein-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000032971
Sequence length 920
Comment (Rattus norvegicus)
Sequence
MQKIMHISVLLPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPH
IDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGT
HPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVG
NINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLG
FTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTY
DAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIK
FDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTI
LESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIW
NGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDP
LAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFS
LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLS
KQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKY
AYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLD
KLKNKWWYDKGECGSGGGDSKTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKE
KTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNPQNINPSSSQNS
QNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences 10116.ENSRNOP00000032971 ENSRNOP00000062152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]