SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000033425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000033425
Domain Number 1 Region: 342-573
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-32
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000033425
Sequence length 678
Comment (Rattus norvegicus)
Sequence
MDQPSRTDESYYETHSGSLDPSHHFHPPSSYPYPHPTLYRPSLGGVLHHESPQHGVSPQP
SQQHAGFYQQNESQHLRGSDFHDSAFPHHSYHQDRAHFSTSPTNVPHTYGGPHPLAESQH
SGGPQDGSHIESYHSHQGNPRKPSVALSHPSSIGSHQGKTHHHYERPQYLDPRQSRRQSD
LSDNLSHRSGEEYQNQERSGLQVGQQQEGQRASSKRGEHRRRRGDYLKYKDRIRHRRPSA
SQLSHKSHSTEGTSPSHMRSKSLASMPQSHLGVQSYVSSQVHSGDSLKESVSWSDEDHVQ
KRKKAQRTHKKAHSGNVFHLIWEKISQLLLGLRQMLLTLTQSLCFETFIFLVVCLNTIVL
VAQTFTELEIRGEWYFMVLDSIFLSIYVIEAFLKLIALGMEYFYDPWNNLDFFIMVMAAL
DFVLLQINSLSYSFYNHSMFRILKVFKSMRALRAIRVLRRLSILTSLHEVTGTLSGSLPS
ITAILSLMFTCLFLFSVVLRALFQESDPKRFNNIFTTLFTLFTMLTLDDWSLIYIDNRAQ
GAWYIIPILVIYIIIQYFIFLNLVIAVLVDNFQMALLKGLEKVKQEQAARVHEKLLDDSL
TDLNKADPDAQMTEETLKTQLIERMFGNMTEKQRKLHFQFLQLVAAVELHQQKFRSQAFV
IDELVDTAFEAGDDDFGK
Download sequence
Identical sequences 10116.ENSRNOP00000033425 ENSRNOP00000033425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]