SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000035155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000035155
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.13e-24
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 91-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000035155
Sequence length 238
Comment (Rattus norvegicus)
Sequence
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSR
SGSIIGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHRSASPERMD
Download sequence
Identical sequences D4A720 Q3THA6
NP_001034124.2.100692 NP_001034124.2.4139 NP_666195.1.92730 ENSRNOP00000035155 10116.ENSRNOP00000035155 ENSMUSP00000070983 ENSMUSP00000070983 ENSRNOP00000035155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]