SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000036139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000036139
Domain Number 1 Region: 242-329
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-20
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Domain Number 2 Region: 155-180
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000772
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000036139
Sequence length 1789
Comment (Rattus norvegicus)
Sequence
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADSDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPVMGTTKAIDDSSASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKTLVGPPPPSYTCFRCGKPGHYIKNCPTNGD
KNFESGPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFL
PEEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTC
HQNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQLPPPPPPISAPRPLIQRNLQPLMR
SPISRQQDPLMIPVTSSSAHSTPSISSLTSNPSSLAPSVPGNPSSAPAPVPDITATVSIS
VHSEKSDGPFRDSDNKLLPAAALASEHSKGASSIAITALMEEKGYQVPVLGTPSLLGQSL
LHGQLIPTTGPVRINAARPGGGRPGWEHSNKLGYLVSPPQQIRRGERSCYRSINRGRHHS
ERSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSV
PPPGFPPAPANISTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLD
EFTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSTRSRSYSRSF
SRSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQ
SPTKRNVPQGETEREYFNRYREVPPPYDIKAYYGRSVDFRDPFEKERYREWERKYREWYE
KYYKGYAVGAQPRPSANREDFSPERLLPLNIRNSPFTRGRREDYVAGQSHRNRNLGGNYP
EKISTRDSHNPKDNPKSKEKESENVPGDGKGNKHKKHRKRRKGEESESFLNPELLETSRK
SRESSGIDETKTDALFVLPSRDDATPVRDEPMDAESITFKSVSEKDKREKDKPKVKSDKT
KRKSDGSATAKKENVLKPSKGPQDKVDGDREKSPRSEPPLKKAKEEATKVDSVKPSSSQK
DEKVTGTPRKAHSKSAKEHQEAKPVKEEKAKKDCSKDIKSEKPASKDEKAKKPEKNKLLE
SKGEKRKRKTEEKSVDFESSSMKISKVEGTEIVKPSPKRKMEGDVEKLERTPEKDKSASS
TTPAKKIKLNRETGKKIGNAENPSTTKEPSEKLESTSNKIKQEKVKGKARRKVAGTEGPS
STLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWD
KDDFESEEEDDVRTTQPIQSVGKPSSIIKNVTTKPSATVKCTEKENEQSEKIQKLTKEVS
HEVIQHELRSSKGSVSSEKGRAKDRDHSASEKDNPDKRKTSIQPDKESTVDRLSEQGHFK
NLSQSSKETRTSEKHESVRGSSNKDFTPGRDKKTDYDSRDYSSSKRRDERSELTRRKDSP
PRSKDSLSGQKSKLREEKDLPKKGTELKKSNSSPPRDKKPHDHKASYETKRSCEETKSVD
KNAGKEREKHAAEASRNGKESSGSKLPSIPNPPDPPMEKELAAGQIEKSTIKPKPQLSHS
SRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEEAVASVSKDLKEKATEKATESLNVAT
ASQPGADRSQSQSSPSVSPSRSHSPSGSQTRSHSSSASSAESQDSKKKKKKKDKKKHKKH
KKHKKHKKHAGVDGDVEKSQKHKHKKKKAKKNKDKEKEKDDQKVKSVTV
Download sequence
Identical sequences G3V953
10116.ENSRNOP00000036139 ENSRNOP00000045663 ENSRNOP00000036139 XP_001076339.1.4139 XP_219296.3.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]