SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000037788 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000037788
Domain Number 1 Region: 26-98
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000011
Family Cold shock DNA-binding domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 146-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000134
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000037788
Sequence length 271
Comment (Rattus norvegicus)
Sequence
MAEGGAGKGEEPEKLPELAEDESQVLRGTGHCKWFNVRMGFGFISMISREGNPLDIPVDV
FVHQSKLFMEGFRSLKEGEPVEFTFKKSPKGLESIRVTGPGGNPCLGSERRPKGKTLQKR
KPKADRWRRQDLLMDQMWTVREEESRMIPRCYNCGGLDHHAKECGLPPQPKKCHYCQSIM
HMVANCPHKLVAQLPASAQGRPEAESQPCTSPSPREVGGGHGCTVPFPQEVTSEMAEQSD
RSPQEVSATKAFAAIGEQNKKGPLIQKRKKT
Download sequence
Identical sequences D3ZIK1
XP_001069344.2.100692 XP_002725925.1.4139 XP_006223991.1.4139 XP_006256663.1.100692 ENSRNOP00000037788 ENSRNOP00000037788 10116.ENSRNOP00000037788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]