SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000038307 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000038307
Domain Number 1 Region: 163-398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-68
Family Tandem AAA-ATPase domain 0.0000559
Further Details:      
 
Domain Number 2 Region: 338-565
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-52
Family Tandem AAA-ATPase domain 0.00096
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000038307
Domain Number - Region: 577-602
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000178
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000038307
Sequence length 621
Comment (Rattus norvegicus)
Sequence
MEEWEPERKRARRNQATAGASHSEDEDEDYVPYVPLRQRRQLLLQKLLQQRRKGAAEEEQ
QDSGSGSEPRGDEDNITLGPQSNVSLLDQHQRLKEKAEARKESAKEKQLKEEEKILESVA
EGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIK
SFKEMKLPAAILRGLKKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIM
FCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLHCALCIGGV
SLKEQMETMRHGVHIMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTI
FSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKM
VYLLECLQKTPPPVLIFAKKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREG
KKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACD
ESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGEQGCAFCGGLGHRITDCPKLEAM
QTKQVSNIGHKDYLAHSSMDF
Download sequence
Identical sequences 10116.ENSRNOP00000038307 ENSRNOP00000038307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]