SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000040587 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000040587
Domain Number 1 Region: 9-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.7e-16
Family Canonical RBD 0.0029
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000040587
Domain Number - Region: 95-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00419
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000040587
Sequence length 212
Comment (Rattus norvegicus)
Sequence
QYGGESKGYVGNLGTGVGKGELERAFSYYGPLRTVWIARNPPGFAFVFEDPRDAEDAVGG
LGGKVICGSRVRVELSTGMPRRSRFDRPPACHPFDPNDRCYECGEQGHYAYDYHRCSRRR
SRSRSRSHSGSKGRRYSYSRSRSCGRRSRSTSPLCSRSTSLRRSKSVSIIGSRSHKVERP
RSCQSKSRSPSPRRSHSPSGSPHRSASPERMD
Download sequence
Identical sequences 10116.ENSRNOP00000040587 ENSRNOP00000040587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]