SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000046315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000046315
Domain Number 1 Region: 509-842
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-48
Family Tandem AAA-ATPase domain 0.00031
Further Details:      
 
Domain Number 2 Region: 375-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000046315
Sequence length 1262
Comment (Rattus norvegicus)
Sequence
MERLATVRARLQDWERAFVRLHGRRPAKEDVEAAPEETRALYREYRNLKQAVSQADDGHR
VQKQSLAKAAEEEQEPSCWGSHLNRAATQNTQSIPKQSPLSSIQDYGKRLKANLKNTLQG
GPTLSRKLQHQKRSLSIVPTSRPPGPRTESPCPEQANDALPQVPVPQPRQGQLQKLQSSL
SLRLSSLDPGWLERCQNRVSDPLEVPGACGLDLSAKESQPQMSGKVNVISPDILSEVSSQ
SPQALAQQPAQVLSQIPKSSNSKDRKRKRNEKGEDFAQAQPSSQAGPLSEGAGATAHGQG
PPGEPTQVTVPQHRCSSNQARTENAKSAAHLPMSPRPASLDRGNYVRLNMKTKCFVRVGA
SRGRLLRKQVWKQKWKKKQEWFGKSGPRATVKDTCFRCGQFGHWASQCSQPGSTLTIQPK
GDRNDKHPISTLGGVAQKTGTTSCNHSGEETEPAGPVLPVPHCPTPVLPLYPPGPLGQVA
DTPAEVFQVLEQLGHHTFRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYAKRS
PCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTKKQRESVLKKVRAAQVHVLIVSPEA
LVGCGAKGPANLPPAAQLPPVAFACIDEVHCLSQWSHNFRPCYLRVCKVLREHMGVRCFL
GLTATATRSTARDVAQHLGIAEELEVSGSASIPANLHLSVSMDRDSDQALVTLLQGDRFR
TLDSIIIYCARRKDTERVAALLRTCLSTVRDSKPRGRGPETLAEAYHAGMCSQERKRVQQ
AFMQGHLRMVVATVAFGMGLDRPDVRAVLHLGLPPSFESYVQAIGRAGRDGKPAHCHLFL
HPQVGNPISPDRETQGYIIPQSLQPQLLSCFPVSCHSGHKCDSCVVPMQGEDLWELSRHV
HADSTDFLAVKKLVQRVFPACSCAQRPMSPLEEVKEHSGQQTYPVLGLACRGHKRALPVQ
STVLALDMKEEAIETLLCYLELHPRHWLELLPYTYAHCHLRCPGGSAQLQALVHRCPPLA
ACWAKWPPKDTSQGSSALEFDVVELADSMGWELASVRQALHQLKWDPEPKKGAPQGTGVL
VEFSELAFHLHSRGDLTDEEKDQICDFLYSRVQAREHKALAHLHQMSKAFQSVAFPSCGP
CLEQSDEGHSNRVKTLVSYYFEEEEEEEEEETMKDTQDPKPGQTQLQDWEDQVRRDVHQL
LSLRPEEKFSGRAVARIFHGIASPCYPAQVFGQDRRFWRKYLHLDFHALMHLATEELLLR
GR
Download sequence
Identical sequences 10116.ENSRNOP00000046315 ENSRNOP00000046315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]