SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000055005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000055005
Domain Number - Region: 57-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0384
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000055005
Sequence length 92
Comment (Rattus norvegicus)
Sequence
MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSDLNPQCLQ
VGHINTGCSWRLPEHSGNCSRESHPRDHHEVQ
Download sequence
Identical sequences D3Z8N0
ENSRNOP00000055005 NP_001102574.1.100692 NP_001102574.1.4139 ENSRNOP00000055005 10116.ENSRNOP00000055005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]