SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000055931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000055931
Domain Number 1 Region: 13-97
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000374
Family Canonical RBD 0.005
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000055931
Domain Number - Region: 86-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000377
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000055931
Sequence length 186
Comment (Rattus norvegicus)
Sequence
MSHNGQGGETKEYVGNLGTGAGKGELERAFGYCGPLRTVWIARNPPGLVFAESEDTRDAE
DAIQGLDGKVICGSRVELSTGLSQRSQFDRPSAHHPFDHNDRCYEYGEKGHYVYDCHRYS
RQRRSKSQSRGRQFVRPRSRSCRKGQARSVSLRRSRSASLRRPRVENIQSRSGSISRSRS
ISRPRS
Download sequence
Identical sequences ENSRNOP00000055931 10116.ENSRNOP00000055931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]