SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000058600 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000058600
Domain Number 1 Region: 123-156
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000785
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000058600
Domain Number - Region: 103-208
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.000392
Family Nickel-iron hydrogenase, small subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000058600
Sequence length 241
Comment (Rattus norvegicus)
Sequence
MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPPAGAAPPELAFGKGRP
EQLGSPLHSSYLNSVFQLQRGETLSSSVYRNASPYGSLNNIADGLSSLTEHFSDLTLTSE
ARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWM
SGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRV
Q
Download sequence
Identical sequences D3ZQ09
ENSRNOP00000058600 10116.ENSRNOP00000058600 ENSRNOP00000058600 NP_001101864.1.100692 NP_001101864.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]